Lineage for d2ncda_ (2ncd A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23359Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 23367Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
  7. 23370Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [52650] (2 PDB entries)
  8. 23371Domain d2ncda_: 2ncd A: [32193]

Details for d2ncda_

PDB Entry: 2ncd (more details), 2.5 Å

PDB Description: ncd (non-claret disjunctional) dimer from d. melanogaster

SCOP Domain Sequences for d2ncda_:

Sequence, based on SEQRES records: (download)

>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster)}
lrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcrirpplese
enrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsa
ldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfl
eiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakmnrata
stagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmtetkninrs
lseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslr
faasvnsc

Sequence, based on observed residues (ATOM records): (download)

>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster)}
lrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcrirpplese
enrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsa
ldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfl
eiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakmnrata
stagnerssrshavtkleligrhaekqeisvgsinlvdlagsespninrslseltnvila
llqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsc

SCOP Domain Coordinates for d2ncda_:

Click to download the PDB-style file with coordinates for d2ncda_.
(The format of our PDB-style files is described here.)

Timeline for d2ncda_: