Lineage for d5ktha1 (5kth A:64-208)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559693Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)
  8. 2559702Domain d5ktha1: 5kth A:64-208 [321923]
    Other proteins in same PDB: d5ktha2, d5ktha3
    automated match to d3whda_
    complexed with 6x7, ca, pge, tre

Details for d5ktha1

PDB Entry: 5kth (more details), 2.21 Å

PDB Description: structure of cow mincle complexed with brartemicin
PDB Compounds: (A:) mincle protein

SCOPe Domain Sequences for d5ktha1:

Sequence, based on SEQRES records: (download)

>d5ktha1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscyndgsgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeq
eflyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatird
ssnprqnwndvpcffnmfrvcempe

Sequence, based on observed residues (ATOM records): (download)

>d5ktha1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscysvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyy
tkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnpr
qnwndvpcffnmfrvcempe

SCOPe Domain Coordinates for d5ktha1:

Click to download the PDB-style file with coordinates for d5ktha1.
(The format of our PDB-style files is described here.)

Timeline for d5ktha1: