SCOPe 2.07: Domain d5ktha1: 5kth A:64-208

Lineage for d5ktha1 (5kth A:64-208)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)

8. Domain d5ktha1: 5kth A:64-208 [321923]
   Other proteins in same PDB: d5ktha2, d5ktha3
   automated match to d3whda_
   complexed with 6x7, ca, pge, tre

Details for d5ktha1

PDB Entry: 5kth, 2.21 Å

PDB Description: structure of cow mincle complexed with brartemicin

PDB Compounds: (A:) mincle protein

SCOPe Domain Sequences for d5ktha1:

Sequence, based on SEQRES records:

>d5ktha1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscyndgsgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeq
eflyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatird
ssnprqnwndvpcffnmfrvcempe

Sequence, based on observed residues (ATOM records):

>d5ktha1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscysvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyy
tkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnpr
qnwndvpcffnmfrvcempe

Timeline for d5ktha1:

• d5ktha1 first appeared in SCOPe 2.06