Lineage for d3kin.2 (3kin C:,D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111623Species Norway rat (Rattus norvegicus) [TaxId:10116] [52648] (2 PDB entries)
  8. 2111626Domain d3kin.2: 3kin C:,D: [32192]
    complexed with adp

Details for d3kin.2

PDB Entry: 3kin (more details), 3.1 Å

PDB Description: kinesin (dimeric) from rattus norvegicus
PDB Compounds: (C:) kinesin heavy chain, (D:) kinesin heavy chain

SCOPe Domain Sequences for d3kin.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g3kin.2 c.37.1.9 (C:,D:) Kinesin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekvXn
kslsalgnvisalaegtkthvpyrdskmtrilqdslggncrttiviccspsvfneaetks
tlmfgqraktikntvsvnleltaeewkkkyekekeknkalksviqhlevelnrw

SCOPe Domain Coordinates for d3kin.2:

Click to download the PDB-style file with coordinates for d3kin.2.
(The format of our PDB-style files is described here.)

Timeline for d3kin.2: