SCOPe 2.08: Domain d5f3da1: 5f3d A:1-298

Lineage for d5f3da1 (5f3d A:1-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.145: NadA-like [142753] (1 superfamily)
   duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134

4. Superfamily c.145.1: NadA-like [142754] (2 families)
   automatically mapped to Pfam PF02445

5. Family c.145.1.0: automated matches [238306] (1 protein)
   not a true family

6. Protein automated matches [238307] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [238308] (15 PDB entries)

8. Domain d5f3da1: 5f3d A:1-298 [321919]
   Other proteins in same PDB: d5f3da2
   automated match to d4p3xa_
   complexed with 5uk, sf4, so4

Details for d5f3da1

PDB Entry: 5f3d, 1.9 Å

PDB Description: structure of quinolinate synthase in complex with reaction intermediate w

PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d5f3da1:

Sequence; same for both SEQRES and ATOM records:

>d5f3da1 c.145.1.0 (A:1-298) automated matches {Thermotoga maritima [TaxId: 243274]}
mvdeilklkkekgyiilahnyqipelqdiadfvgdslqlarkamelsekkilflgvdfma
elvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlfvnstsecktladv
ictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnaesida
vrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihklkkk
fpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfelmg

Timeline for d5f3da1:

• d5f3da1 first appeared in SCOPe 2.06
  
• d5f3da1 appears in SCOPe 2.07