Lineage for d5el2a_ (5el2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711930Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2711931Protein automated matches [191085] (10 species)
    not a true protein
  7. 2711950Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries)
  8. 2711957Domain d5el2a_: 5el2 A: [321918]
    automated match to d3n7ha_
    complexed with kbr, mg

Details for d5el2a_

PDB Entry: 5el2 (more details), 1.75 Å

PDB Description: crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with icaridin (butan-2-yl 2-(2-hydroxyethyl)piperidine-1- carboxylate)
PDB Compounds: (A:) agap003309-pa

SCOPe Domain Sequences for d5el2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5el2a_ a.39.2.0 (A:) automated matches {Anopheles gambiae [TaxId: 180454]}
dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
hyflv

SCOPe Domain Coordinates for d5el2a_:

Click to download the PDB-style file with coordinates for d5el2a_.
(The format of our PDB-style files is described here.)

Timeline for d5el2a_: