Lineage for d5dg5b_ (5dg5 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981716Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981717Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries)
  8. 2981796Domain d5dg5b_: 5dg5 B: [321914]
    automated match to d4eeva_
    complexed with 5b4

Details for d5dg5b_

PDB Entry: 5dg5 (more details), 2.6 Å

PDB Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with altiratinib analog dp- 4157
PDB Compounds: (B:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d5dg5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dg5b_ d.144.1.7 (B:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

SCOPe Domain Coordinates for d5dg5b_:

Click to download the PDB-style file with coordinates for d5dg5b_.
(The format of our PDB-style files is described here.)

Timeline for d5dg5b_: