Lineage for d5e5ra_ (5e5r A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078893Species Human (Homo sapiens) [TaxId:9606] [188766] (12 PDB entries)
  8. 2078921Domain d5e5ra_: 5e5r A: [321913]
    Other proteins in same PDB: d5e5rb1, d5e5rb2, d5e5rd1, d5e5rd2
    automated match to d3kldb_
    complexed with fmt, mli

Details for d5e5ra_

PDB Entry: 5e5r (more details), 2.6 Å

PDB Description: crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn3
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d5e5ra_:

Sequence, based on SEQRES records: (download)

>d5e5ra_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnkt
wmkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemq
iffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldp
fvlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdh
vksveylrnnfrpqqrlhdrvvsks

Sequence, based on observed residues (ATOM records): (download)

>d5e5ra_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdpywaysgaygpehwvtssvscggrhqspidildqyarelqldgfdnessnktwmkntg
ktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsngrrfpvemqiffynpd
dfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfvlrdll
paslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhvksveyl
rnnfrpqqrlhdrvvsks

SCOPe Domain Coordinates for d5e5ra_:

Click to download the PDB-style file with coordinates for d5e5ra_.
(The format of our PDB-style files is described here.)

Timeline for d5e5ra_: