Lineage for d5i8na_ (5i8n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996383Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1996615Protein automated matches [190132] (4 species)
    not a true protein
  7. 1996618Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)
  8. 1996726Domain d5i8na_: 5i8n A: [321911]
    automated match to d4ggfl_

Details for d5i8na_

PDB Entry: 5i8n (more details)

PDB Description: solution structure of human calcium-binding s100a9 (c3s) protein
PDB Compounds: (A:) Protein S100-A9

SCOPe Domain Sequences for d5i8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i8na_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp

SCOPe Domain Coordinates for d5i8na_:

Click to download the PDB-style file with coordinates for d5i8na_.
(The format of our PDB-style files is described here.)

Timeline for d5i8na_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5i8nb_