SCOPe 2.08: Domain d5jvoa_: 5jvo A:

Lineage for d5jvoa_ (5jvo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.0: automated matches [194896] (1 protein)
   not a true family

6. Protein automated matches [194897] (4 species)
   not a true protein

7. Species Corynebacterium pseudotuberculosis [TaxId:1719] [321904] (1 PDB entry)

8. Domain d5jvoa_: 5jvo A: [321905]
   automated match to d2zfzd_
   complexed with so4, tyr

Details for d5jvoa_

PDB Entry: 5jvo, 1.9 Å

PDB Description: crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis

PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d5jvoa_:

Sequence; same for both SEQRES and ATOM records:

>d5jvoa_ d.74.2.0 (A:) automated matches {Corynebacterium pseudotuberculosis [TaxId: 1719]}
gtreklrkmlddllvsvdhsgniavlrtppggapflasfidrvgmeevvgtiagddtvfv
lardpmtgqelgeflsqrr

Timeline for d5jvoa_:

• d5jvoa_ first appeared in SCOPe 2.06
  
• d5jvoa_ appears in SCOPe 2.07