Lineage for d2kin.1 (2kin A:,B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.9: Motor proteins [52641] (3 proteins) 
Protein Kinesin [52646] (5 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [52648] (2 PDB entries) 
Domain d2kin.1: 2kin A:,B: [32190]
Details for d2kin.1
PDB Entry: 2kin (more details), 1.9 Å
PDB Description: kinesin (monomeric) from rattus norvegicus
SCOP Domain Sequences for d2kin.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2kin.1 c.37.1.9 (A:,B:) Kinesin {Rat (Rattus norvegicus)}
adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekvXa
kninkslsalgnvisalaegtkthvpyrdskmtrilqdsldgncrttiviccspsvfnea
etkstlmfgqraktikntvsvnleltaeewkkkyekeke
SCOP Domain Coordinates for d2kin.1:
Click to download the PDB-style file with coordinates for d2kin.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2kin.1:
- d2kin.1 first appeared (with stable ids) in SCOP 1.55
- d2kin.1 appears in SCOP 1.57
- d2kin.1 appears in SCOP 1.61
- d2kin.1 appears in the current release, SCOPe 2.08
View in 3D