Lineage for d2kin.1 (2kin A:,B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111623Species Norway rat (Rattus norvegicus) [TaxId:10116] [52648] (2 PDB entries)
  8. 2111624Domain d2kin.1: 2kin A:,B: [32190]
    complexed with adp, so4

Details for d2kin.1

PDB Entry: 2kin (more details), 2 Å

PDB Description: kinesin (monomeric) from rattus norvegicus
PDB Compounds: (A:) kinesin, (B:) kinesin

SCOPe Domain Sequences for d2kin.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2kin.1 c.37.1.9 (A:,B:) Kinesin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekvXa
kninkslsalgnvisalaegtkthvpyrdskmtrilqdsldgncrttiviccspsvfnea
etkstlmfgqraktikntvsvnleltaeewkkkyekeke

SCOPe Domain Coordinates for d2kin.1:

Click to download the PDB-style file with coordinates for d2kin.1.
(The format of our PDB-style files is described here.)

Timeline for d2kin.1: