Lineage for d5iraa1 (5ira A:14-134)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073250Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2073570Protein automated matches [190191] (2 species)
    not a true protein
  7. 2073663Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)
  8. 2073740Domain d5iraa1: 5ira A:14-134 [321895]
    Other proteins in same PDB: d5iraa2
    automated match to d2bc3b_
    complexed with 9ru

Details for d5iraa1

PDB Entry: 5ira (more details), 1.5 Å

PDB Description: expanding nature's catalytic repertoire -directed evolution of an artificial metalloenzyme for in vivo metathesis
PDB Compounds: (A:) Artificial Metathesase

SCOPe Domain Sequences for d5iraa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iraa1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

SCOPe Domain Coordinates for d5iraa1:

Click to download the PDB-style file with coordinates for d5iraa1.
(The format of our PDB-style files is described here.)

Timeline for d5iraa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iraa2