Lineage for d5e5rc_ (5e5r C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (14 species)
    not a true protein
  7. 2402364Species Human (Homo sapiens) [TaxId:9606] [188766] (17 PDB entries)
  8. 2402393Domain d5e5rc_: 5e5r C: [321892]
    Other proteins in same PDB: d5e5rb1, d5e5rb2, d5e5rd1, d5e5rd2
    automated match to d3kldb_
    complexed with fmt, mli

Details for d5e5rc_

PDB Entry: 5e5r (more details), 2.6 Å

PDB Description: crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn3
PDB Compounds: (C:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d5e5rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e5rc_ b.74.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnktw
mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemqi
ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf
vlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv
ksveylrnnfrpqqrlhdrvvsks

SCOPe Domain Coordinates for d5e5rc_:

Click to download the PDB-style file with coordinates for d5e5rc_.
(The format of our PDB-style files is described here.)

Timeline for d5e5rc_: