| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5e5rb1: 5e5r B:125-222 [321890] Other proteins in same PDB: d5e5ra_, d5e5rc_ automated match to d3s97c1 complexed with fmt, mli |
PDB Entry: 5e5r (more details), 2.6 Å
SCOPe Domain Sequences for d5e5rb1:
Sequence, based on SEQRES records: (download)
>d5e5rb1 b.1.1.0 (B:125-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ktrmrstvsvregqgvvllcgppphsgelsyawvfneypsfveedsrrfvsqetghlyia
kvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvm
>d5e5rb1 b.1.1.0 (B:125-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ktrmrstvsvregqgvvllcgppelsyawvfneypfveedsrrfvsqetghlyiakveps
dvgnytcvvtstvtntrvlgsptplvlrsdgvm
Timeline for d5e5rb1:
View in 3DDomains from other chains: (mouse over for more information) d5e5ra_, d5e5rc_, d5e5rd1, d5e5rd2 |