Lineage for d1bg2__ (1bg2 -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313890Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 313891Protein Kinesin [52646] (5 species)
  7. 313892Species Human (Homo sapiens) [TaxId:9606] [52647] (2 PDB entries)
  8. 313893Domain d1bg2__: 1bg2 - [32189]
    complexed with act, adp, mg

Details for d1bg2__

PDB Entry: 1bg2 (more details), 1.8 Å

PDB Description: human ubiquitous kinesin motor domain

SCOP Domain Sequences for d1bg2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg2__ c.37.1.9 (-) Kinesin {Human (Homo sapiens)}
dlaecnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvy
ndcakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysm
denlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgcterfvcspdevmdt
idegksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktg
aegavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggncrttivicc
spssynesetkstllfgqrakti

SCOP Domain Coordinates for d1bg2__:

Click to download the PDB-style file with coordinates for d1bg2__.
(The format of our PDB-style files is described here.)

Timeline for d1bg2__: