Lineage for d1bg2a_ (1bg2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111572Species Human (Homo sapiens) [TaxId:9606] [52647] (3 PDB entries)
  8. 2111573Domain d1bg2a_: 1bg2 A: [32189]
    complexed with act, adp, mg

Details for d1bg2a_

PDB Entry: 1bg2 (more details), 1.8 Å

PDB Description: human ubiquitous kinesin motor domain
PDB Compounds: (A:) kinesin

SCOPe Domain Sequences for d1bg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]}
dlaecnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvy
ndcakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysm
denlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgcterfvcspdevmdt
idegksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktg
aegavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggncrttivicc
spssynesetkstllfgqrakti

SCOPe Domain Coordinates for d1bg2a_:

Click to download the PDB-style file with coordinates for d1bg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1bg2a_: