Lineage for d5ffla_ (5ffl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759644Domain d5ffla_: 5ffl A: [321889]
    automated match to d1zoxa_
    complexed with epe, mpd, na

Details for d5ffla_

PDB Entry: 5ffl (more details), 1.6 Å

PDB Description: crystal structure of mouse cd300lf at 1.6 angstroms resolution.
PDB Compounds: (A:) CD300 antigen-like family member F

SCOPe Domain Sequences for d5ffla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffla_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
medpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkk
nrvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt

SCOPe Domain Coordinates for d5ffla_:

Click to download the PDB-style file with coordinates for d5ffla_.
(The format of our PDB-style files is described here.)

Timeline for d5ffla_: