| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
| Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
| Protein automated matches [191085] (10 species) not a true protein |
| Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries) |
| Domain d5el2b_: 5el2 B: [321880] automated match to d3n7ha_ complexed with kbr, mg |
PDB Entry: 5el2 (more details), 1.75 Å
SCOPe Domain Sequences for d5el2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5el2b_ a.39.2.0 (B:) automated matches {Anopheles gambiae [TaxId: 180454]}
dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
hyflv
Timeline for d5el2b_: