Lineage for d1mnd_2 (1mnd 2-33,80-690)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23359Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 23376Protein Myosin S1, motor domain [52642] (3 species)
  7. 23398Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (16 PDB entries)
  8. 23414Domain d1mnd_2: 1mnd 2-33,80-690 [32188]
    Other proteins in same PDB: d1mnd_1

Details for d1mnd_2

PDB Entry: 1mnd (more details), 2.6 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mgadp-alf4

SCOP Domain Sequences for d1mnd_2:

Sequence, based on SEQRES records: (download)

>d1mnd_2 c.37.1.9 (2-33,80-690) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum)}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrk

Sequence, based on observed residues (ATOM records): (download)

>d1mnd_2 c.37.1.9 (2-33,80-690) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum)}
npihdrtsdyhkylkvkqtvsdkrXrnpikfdgvedmselsylnepavfhnlrvrynqdl
iytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqs
llitgesgagktentkkviqylasvagvleqqilqanpileafgnakttrnnnssrfgkf
ieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpe
sfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekg
agegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalv
kalygrlflwlvkkinnvlcsraayfigvldisgfeifkvnsfeqlcinytneklqqffn
hhmdsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskknakyeeprfsk
tefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndpniasrfitva
aqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcngvleiritrk

SCOP Domain Coordinates for d1mnd_2:

Click to download the PDB-style file with coordinates for d1mnd_2.
(The format of our PDB-style files is described here.)

Timeline for d1mnd_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnd_1