Lineage for d1mnea2 (1mne A:2-33,A:80-759)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696444Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 696518Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 696552Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (18 PDB entries)
  8. 696569Domain d1mnea2: 1mne A:2-33,A:80-759 [32187]
    Other proteins in same PDB: d1mnea1
    complexed with mg, pop; mutant

Details for d1mnea2

PDB Entry: 1mne (more details), 2.7 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mg-pyrophosphate
PDB Compounds: (A:) myosin

SCOP Domain Sequences for d1mnea2:

Sequence, based on SEQRES records: (download)

>d1mnea2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryy
llapnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeare

Sequence, based on observed residues (ATOM records): (download)

>d1mnea2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqgvleqqilqanpileafgnakt
trnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagata
eekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiag
ilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhln
vekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlc
inytneklqqffnhhmfkveqeeylkekinldsqatidlidgrqppgilalldeqsvfpn
atdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdle
lcfkdssdnvvtklfndpniasrafitvaaqykeqlaslmatlettnphfvrciipnnkq
lpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqka
tdavlkhlnidpeqyrfgitkiffragqlarieeare

SCOP Domain Coordinates for d1mnea2:

Click to download the PDB-style file with coordinates for d1mnea2.
(The format of our PDB-style files is described here.)

Timeline for d1mnea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnea1