SCOPe 2.08: Domain d5itsb1: 5its B:3-195

Lineage for d5itsb1 (5its B:3-195)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (6 families)

5. Family c.129.1.0: automated matches [233357] (1 protein)
   not a true family

6. Protein automated matches [233358] (8 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [321750] (2 PDB entries)

8. Domain d5itsb1: 5its B:3-195 [321864]
   Other proteins in same PDB: d5itsb2, d5itsd2
   automated match to d1t35e_
   complexed with gol, po4

Details for d5itsb1

PDB Entry: 5its, 2.3 Å

PDB Description: crystal structure of log from corynebacterium glutamicum

PDB Compounds: (B:) Cytokinin riboside 5'-monophosphate phosphoribohydrolase

SCOPe Domain Sequences for d5itsb1:

Sequence; same for both SEQRES and ATOM records:

>d5itsb1 c.129.1.0 (B:3-195) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
slfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaf
lesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtlee
lfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphall
kamqtwtppapkw

Timeline for d5itsb1:

• d5itsb1 first appeared in SCOPe 2.06
  
• d5itsb1 appears in SCOPe 2.07