SCOPe 2.08: Domain d5lpna_: 5lpn A:

Lineage for d5lpna_ (5lpn A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d5lpna_: 5lpn A: [321863]
   automated match to d2j0vd_
   complexed with gnp, mg

Details for d5lpna_

PDB Entry: 5lpn, 2.8 Å

PDB Description: structure of human rab10 in complex with the bmerb domain of mical-1

PDB Compounds: (A:) Ras-related protein Rab-10

SCOPe Domain Sequences for d5lpna_:

Sequence; same for both SEQRES and ATOM records:

>d5lpna_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tydllfkllligdsgvgktcvlfrfsddafnttfistigidfkiktvelqgkkiklqiwd
tagqerfhtittsyyrgamgimlvyditngksfeniskwlrnidehanedvermllgnkc
dmddkrvvpkgkgeqiarehgirffetsakaniniekafltlaedilrktp

Timeline for d5lpna_:

• d5lpna_ first appeared in SCOPe 2.06
  
• d5lpna_ appears in SCOPe 2.07