SCOPe 2.08: Domain d5lp7h2: 5lp7 H:269-393

Lineage for d5lp7h2 (5lp7 H:269-393)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries)

8. Domain d5lp7h2: 5lp7 H:269-393 [321862]
   automated match to d3goaa2
   complexed with gol

Details for d5lp7h2

PDB Entry: 5lp7, 2.2 Å

PDB Description: crystal structure of 3-ketoacyl-coa thiolase (mmga) from bacillus subtilis.

PDB Compounds: (H:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5lp7h2:

Sequence; same for both SEQRES and ATOM records:

>d5lp7h2 c.95.1.0 (H:269-393) automated matches {Bacillus subtilis [TaxId: 224308]}
gkrplatilgfsttgmpahelaaapgfainkllkkngltvqdidlfevneafasvvltce
kivgfdlekvnvnggaialghpigasgarilmtlvyelkrrggglgvaaicsgaaqgdav
lvqvh

Timeline for d5lp7h2:

• d5lp7h2 first appeared in SCOPe 2.06
  
• d5lp7h2 appears in SCOPe 2.07