SCOPe 2.06: Domain d5kwyc1: 5kwy C:20-151

Lineage for d5kwyc1 (5kwy C:20-151)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (3 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein automated matches [321839] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [321840] (1 PDB entry)

8. Domain d5kwyc1: 5kwy C:20-151 [321852]
   Other proteins in same PDB: d5kwyc2
   automated match to d1nepa_
   complexed with c3s, nag

Details for d5kwyc1

PDB Entry: 5kwy, 2.41 Å

PDB Description: structure of human npc1 middle lumenal domain bound to npc2

PDB Compounds: (C:) Epididymal secretory protein E1

SCOPe Domain Sequences for d5kwyc1:

Sequence; same for both SEQRES and ATOM records:

>d5kwyc1 b.1.18.7 (C:20-151) automated matches {Homo sapiens [TaxId: 9606]}
epvqfkdcgsvdgvikevnvspcptqpcqlskgqsysvnvtftsniqsksskavvhgilm
gvpvpfpipepdgcksgincpiqkdktysylnklpvkseypsiklvvewqlqddknqslf
cweipvqivshl

Timeline for d5kwyc1:

• d5kwyc1 is new in SCOPe 2.06-stable
  
• d5kwyc1 appears in SCOPe 2.07
  
• d5kwyc1 appears in the current release, SCOPe 2.08