Lineage for d5kwyc1 (5kwy C:20-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765571Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2765593Protein automated matches [321839] (2 species)
    not a true protein
  7. 2765596Species Human (Homo sapiens) [TaxId:9606] [321840] (1 PDB entry)
  8. 2765597Domain d5kwyc1: 5kwy C:20-151 [321852]
    Other proteins in same PDB: d5kwyc2
    automated match to d1nepa_
    complexed with c3s, nag

Details for d5kwyc1

PDB Entry: 5kwy (more details), 2.41 Å

PDB Description: structure of human npc1 middle lumenal domain bound to npc2
PDB Compounds: (C:) Epididymal secretory protein E1

SCOPe Domain Sequences for d5kwyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwyc1 b.1.18.7 (C:20-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvqfkdcgsvdgvikevnvspcptqpcqlskgqsysvnvtftsniqsksskavvhgilm
gvpvpfpipepdgcksgincpiqkdktysylnklpvkseypsiklvvewqlqddknqslf
cweipvqivshl

SCOPe Domain Coordinates for d5kwyc1:

Click to download the PDB-style file with coordinates for d5kwyc1.
(The format of our PDB-style files is described here.)

Timeline for d5kwyc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kwyc2
View in 3D
Domains from other chains:
(mouse over for more information)
d5kwyd_