Lineage for d5lmzb1 (5lmz B:8-192)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923098Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2923099Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2923100Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 2923142Protein automated matches [254631] (2 species)
    not a true protein
  7. 2923156Species Streptomyces sp. [TaxId:1400207] [321772] (2 PDB entries)
  8. 2923160Domain d5lmzb1: 5lmz B:8-192 [321837]
    Other proteins in same PDB: d5lmza2, d5lmzb2
    automated match to d1rqpa2
    complexed with 1da, cl, gol

Details for d5lmzb1

PDB Entry: 5lmz (more details), 2.55 Å

PDB Description: fluorinase from streptomyces sp. ma37
PDB Compounds: (B:) Fluorinase

SCOPe Domain Sequences for d5lmzb1:

Sequence, based on SEQRES records: (download)

>d5lmzb1 c.132.1.1 (B:8-192) automated matches {Streptomyces sp. [TaxId: 1400207]}
rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsyiyiapnngll
ttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddsei
vrfhr

Sequence, based on observed residues (ATOM records): (download)

>d5lmzb1 c.132.1.1 (B:8-192) automated matches {Streptomyces sp. [TaxId: 1400207]}
rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrirqaaqwagsgdgferadgsyiyiapnngllttvlee
hgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddseivrfhr

SCOPe Domain Coordinates for d5lmzb1:

Click to download the PDB-style file with coordinates for d5lmzb1.
(The format of our PDB-style files is described here.)

Timeline for d5lmzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lmzb2