Lineage for d5sx0a1 (5sx0 A:36-443)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328762Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2328763Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2328776Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2328933Domain d5sx0a1: 5sx0 A:36-443 [321833]
    automated match to d3n3oa1
    complexed with hem, mpd, na, o, oxy, trs

Details for d5sx0a1

PDB Entry: 5sx0 (more details), 2 Å

PDB Description: crystal structure of an oxoferryl species of catalase-peroxidase katg at ph7.5
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5sx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sx0a1 a.93.1.3 (A:36-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d5sx0a1:

Click to download the PDB-style file with coordinates for d5sx0a1.
(The format of our PDB-style files is described here.)

Timeline for d5sx0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sx0a2