![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
![]() | Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) ![]() |
![]() | Family c.129.1.0: automated matches [233357] (1 protein) not a true family |
![]() | Protein automated matches [233358] (8 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:196627] [321750] (2 PDB entries) |
![]() | Domain d5itsd1: 5its D:2-195 [321828] Other proteins in same PDB: d5itsb2, d5itsd2 automated match to d1t35e_ complexed with gol, po4 |
PDB Entry: 5its (more details), 2.3 Å
SCOPe Domain Sequences for d5itsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5itsd1 c.129.1.0 (D:2-195) automated matches {Corynebacterium glutamicum [TaxId: 196627]} tslfdaptlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivada flesggeafgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtle elfevwtwqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphal lkamqtwtppapkw
Timeline for d5itsd1:
![]() Domains from other chains: (mouse over for more information) d5itsa_, d5itsb1, d5itsb2, d5itsc_ |