Lineage for d5jtnc_ (5jtn C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. Family d.33.1.0: automated matches [321736] (1 protein)
    not a true family
  6. Protein automated matches [321737] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries)
  8. Domain d5jtnc_: 5jtn C: [321824]
    automated match to d1fx3b_

Details for d5jtnc_

PDB Entry: 5jtn (more details)

PDB Description: the structure of chaperone secb in complex with unstructured prophoa binding site c
PDB Compounds: (C:) protein-export protein secb

SCOPe Domain Sequences for d5jtnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtnc_ d.33.1.0 (C:) automated matches {Escherichia coli [TaxId: 83334]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda

SCOPe Domain Coordinates for d5jtnc_ are not available.

Timeline for d5jtnc_:

Domains from other chains:
(mouse over for more information)
d5jtna_, d5jtnb_, d5jtnd_