![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries) |
![]() | Domain d5lp7b1: 5lp7 B:2-268 [321818] automated match to d3goaa1 complexed with gol |
PDB Entry: 5lp7 (more details), 2.2 Å
SCOPe Domain Sequences for d5lp7b1:
Sequence, based on SEQRES records: (download)
>d5lp7b1 c.95.1.0 (B:2-268) automated matches {Bacillus subtilis [TaxId: 224308]} rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr sharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdgs itagnapgvndgagafvlmseekaael
>d5lp7b1 c.95.1.0 (B:2-268) automated matches {Bacillus subtilis [TaxId: 224308]} rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr sharaakaadegkfqdeivpvnwigkpnvvdkdeairrdtsldqlaklapiysdgsitag napgvndgagafvlmseekaael
Timeline for d5lp7b1: