Lineage for d5k3gd3 (5k3g D:487-669)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708627Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries)
  8. 2708671Domain d5k3gd3: 5k3g D:487-669 [321817]
    Other proteins in same PDB: d5k3ga1, d5k3gb1, d5k3gc1, d5k3gd1
    automated match to d2ddha2

Details for d5k3gd3

PDB Entry: 5k3g (more details), 2.86 Å

PDB Description: crystals structure of acyl-coa oxidase-1 in caenorhabditis elegans, apo form-i
PDB Compounds: (D:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3gd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3gd3 a.29.3.0 (D:487-669) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
giteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfivea
farrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqk
irpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmm
eka

SCOPe Domain Coordinates for d5k3gd3:

Click to download the PDB-style file with coordinates for d5k3gd3.
(The format of our PDB-style files is described here.)

Timeline for d5k3gd3: