Lineage for d5jtod_ (5jto D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550149Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2550150Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2550181Family d.33.1.0: automated matches [321736] (1 protein)
    not a true family
  6. 2550182Protein automated matches [321737] (2 species)
    not a true protein
  7. 2550188Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries)
  8. 2550204Domain d5jtod_: 5jto D: [321795]
    automated match to d1fx3b_

Details for d5jtod_

PDB Entry: 5jto (more details)

PDB Description: the structure of chaperone secb in complex with unstructured prophoa binding site d
PDB Compounds: (D:) protein-export protein secb

SCOPe Domain Sequences for d5jtod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtod_ d.33.1.0 (D:) automated matches {Escherichia coli [TaxId: 83334]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda

SCOPe Domain Coordinates for d5jtod_:

Click to download the PDB-style file with coordinates for d5jtod_.
(The format of our PDB-style files is described here.)

Timeline for d5jtod_: