| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
Superfamily d.33.1: SecB-like [54611] (3 families) ![]() |
| Family d.33.1.0: automated matches [321736] (1 protein) not a true family |
| Protein automated matches [321737] (2 species) not a true protein |
| Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries) |
| Domain d5jtod_: 5jto D: [321795] automated match to d1fx3b_ |
PDB Entry: 5jto (more details)
SCOPe Domain Sequences for d5jtod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jtod_ d.33.1.0 (D:) automated matches {Escherichia coli [TaxId: 83334]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda
Timeline for d5jtod_: