Lineage for d5sw4a2 (5sw4 A:444-748)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720495Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2720496Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2720509Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2720631Domain d5sw4a2: 5sw4 A:444-748 [321793]
    automated match to d3n3ra2
    complexed with hem, mpd, na, oxy, po4, trs

Details for d5sw4a2

PDB Entry: 5sw4 (more details), 1.9 Å

PDB Description: crystal structure of native catalase-peroxidase katg at ph8.0
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5sw4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sw4a2 a.93.1.3 (A:444-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

SCOPe Domain Coordinates for d5sw4a2:

Click to download the PDB-style file with coordinates for d5sw4a2.
(The format of our PDB-style files is described here.)

Timeline for d5sw4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sw4a1