Lineage for d1mmna2 (1mmn A:2-33,A:80-759)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 830794Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 830883Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 830917Species Dictyostelium discoideum [TaxId:44689] [52645] (18 PDB entries)
  8. 830929Domain d1mmna2: 1mmn A:2-33,A:80-759 [32179]
    Other proteins in same PDB: d1mmna1
    complexed with anp, mg; mutant

Details for d1mmna2

PDB Entry: 1mmn (more details), 2.1 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
PDB Compounds: (A:) myosin

SCOP Domain Sequences for d1mmna2:

Sequence, based on SEQRES records: (download)

>d1mmna2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqstternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdeeefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryy
dlapnvprdaedsqkatdavlkhlnidpeqfrfgitkiffragqlarieeare

Sequence, based on observed residues (ATOM records): (download)

>d1mmna2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvaggvleqqilqanpileafgnakttrn
nnssrfgkfieiqfnnagfisgasiqsylleksrvvfqstternyhifyqllagataeek
kalhlagpesfnylnqsgcvdikgvsdeeefkitrqamdivgfsqeeqmsifkiiagilh
lgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvek
ssssrdalvkalygrlflwlvkkinnvlcserkayfigvldisgfeifkvnsfeqlciny
tneklqqffnhhmfkveqeeylkekidsqatidlidgrqppgilalldeqsvfpnatdnt
litklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkd
ssdnvvtklfndpniasrafitvaaqykeqlaslmatlettnphfvrciipnnkqlpakl
edkvvldqlrcngvlegiritrkgfpnriiyadfvkryydlapnvprdaedsqkatdavl
khlnidpeqfrfgitkiffragqlarieeare

SCOP Domain Coordinates for d1mmna2:

Click to download the PDB-style file with coordinates for d1mmna2.
(The format of our PDB-style files is described here.)

Timeline for d1mmna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmna1