Lineage for d5dasd1 (5das D:4-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861043Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries)
  8. 2861061Domain d5dasd1: 5das D:4-200 [321785]
    Other proteins in same PDB: d5dasa2, d5dasb2, d5dasc2, d5dasd2
    automated match to d4s1ob_
    complexed with nap

Details for d5dasd1

PDB Entry: 5das (more details), 2.2 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2
PDB Compounds: (D:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5dasd1:

Sequence, based on SEQRES records: (download)

>d5dasd1 c.26.1.0 (D:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records): (download)

>d5dasd1 c.26.1.0 (D:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviatasnp
rfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimseelfelarfvgvs
rpaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt

SCOPe Domain Coordinates for d5dasd1:

Click to download the PDB-style file with coordinates for d5dasd1.
(The format of our PDB-style files is described here.)

Timeline for d5dasd1: