Lineage for d5lmza2 (5lmz A:193-298)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077711Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2077712Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2077755Family b.141.1.0: automated matches [227220] (1 protein)
    not a true family
  6. 2077756Protein automated matches [226959] (3 species)
    not a true protein
  7. 2278473Species Streptomyces sp. [TaxId:1400207] [321774] (2 PDB entries)
  8. 2278474Domain d5lmza2: 5lmz A:193-298 [321775]
    Other proteins in same PDB: d5lmza1, d5lmzb1
    automated match to d1rqpa1
    complexed with 1da, cl, gol

Details for d5lmza2

PDB Entry: 5lmz (more details), 2.55 Å

PDB Description: fluorinase from streptomyces sp. ma37
PDB Compounds: (A:) Fluorinase

SCOPe Domain Sequences for d5lmza2:

Sequence, based on SEQRES records: (download)

>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]}
paveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltp
tfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvea

Sequence, based on observed residues (ATOM records): (download)

>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]}
pavealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptfad
agaigniafylnsrgylslarnaaslaypynlkaglkvrvea

SCOPe Domain Coordinates for d5lmza2:

Click to download the PDB-style file with coordinates for d5lmza2.
(The format of our PDB-style files is described here.)

Timeline for d5lmza2:

  • d5lmza2 appears in periodic updates to SCOPe 2.06 starting on 2016-08-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5lmza1