![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
![]() | Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) ![]() |
![]() | Family b.141.1.0: automated matches [227220] (1 protein) not a true family |
![]() | Protein automated matches [226959] (3 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:1400207] [321774] (2 PDB entries) |
![]() | Domain d5lmza2: 5lmz A:193-298 [321775] Other proteins in same PDB: d5lmza1, d5lmzb1 automated match to d1rqpa1 complexed with 1da, cl, gol |
PDB Entry: 5lmz (more details), 2.55 Å
SCOPe Domain Sequences for d5lmza2:
Sequence, based on SEQRES records: (download)
>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]} paveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltp tfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvea
>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]} pavealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptfad agaigniafylnsrgylslarnaaslaypynlkaglkvrvea
Timeline for d5lmza2: