SCOPe 2.07: Domain d5lmza2: 5lmz A:193-298

Lineage for d5lmza2 (5lmz A:193-298)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.0: automated matches [227220] (1 protein)
   not a true family

6. Protein automated matches [226959] (3 species)
   not a true protein

7. Species Streptomyces sp. [TaxId:1400207] [321774] (2 PDB entries)

8. Domain d5lmza2: 5lmz A:193-298 [321775]
   Other proteins in same PDB: d5lmza1, d5lmzb1
   automated match to d1rqpa1
   complexed with 1da, cl, gol

Details for d5lmza2

PDB Entry: 5lmz, 2.55 Å

PDB Description: fluorinase from streptomyces sp. ma37

PDB Compounds: (A:) Fluorinase

SCOPe Domain Sequences for d5lmza2:

Sequence, based on SEQRES records:

>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]}
paveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltp
tfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvea

Sequence, based on observed residues (ATOM records):

>d5lmza2 b.141.1.0 (A:193-298) automated matches {Streptomyces sp. [TaxId: 1400207]}
pavealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptfad
agaigniafylnsrgylslarnaaslaypynlkaglkvrvea

Timeline for d5lmza2:

• d5lmza2 first appeared in SCOPe 2.06