Lineage for d1fmva2 (1fmv A:2-33,A:80-759)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111685Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (18 PDB entries)
  8. 2111693Domain d1fmva2: 1fmv A:2-33,A:80-759 [32177]
    Other proteins in same PDB: d1fmva1
    complexed with cl

Details for d1fmva2

PDB Entry: 1fmv (more details), 2.1 Å

PDB Description: crystal structure of the apo motor domain of dictyostellium myosin ii
PDB Compounds: (A:) myosin II heavy chain

SCOPe Domain Sequences for d1fmva2:

Sequence, based on SEQRES records: (download)

>d1fmva2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryy
llapnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeare

Sequence, based on observed residues (ATOM records): (download)

>d1fmva2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrgvleqqilqanpileafgnakttr
nnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataee
kkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagil
hlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnve
kssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcin
ytneklqqffnhhmfkveqeeylkekinwgldsqatidlidgrqppgilalldeqsvfpn
atdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdle
lcfkdssdnvvtklfndpniasranfitvaaqykeqlaslmatlettnphfvrciipnnk
qlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqk
atdavlkhlnidpeqyrfgitkiffragqlarieeare

SCOPe Domain Coordinates for d1fmva2:

Click to download the PDB-style file with coordinates for d1fmva2.
(The format of our PDB-style files is described here.)

Timeline for d1fmva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fmva1