Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Ileal lipid-binding protein [50870] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82159] (6 PDB entries) |
Domain d5l8nb_: 5l8n B: [321764] automated match to d1o1va_ complexed with 6rq, p33, peg |
PDB Entry: 5l8n (more details), 2.12 Å
SCOPe Domain Sequences for d5l8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8nb_ b.60.1.2 (B:) Ileal lipid-binding protein {Human (Homo sapiens) [TaxId: 9606]} aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye rvskrl
Timeline for d5l8nb_: