Lineage for d5l8nb_ (5l8n B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805100Protein Ileal lipid-binding protein [50870] (2 species)
  7. 2805101Species Human (Homo sapiens) [TaxId:9606] [82159] (6 PDB entries)
  8. 2805106Domain d5l8nb_: 5l8n B: [321764]
    automated match to d1o1va_
    complexed with 6rq, p33, peg

Details for d5l8nb_

PDB Entry: 5l8n (more details), 2.12 Å

PDB Description: crystal structure of human fabp6 protein with fragment 1
PDB Compounds: (B:) Gastrotropin

SCOPe Domain Sequences for d5l8nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8nb_ b.60.1.2 (B:) Ileal lipid-binding protein {Human (Homo sapiens) [TaxId: 9606]}
aftgkfemeseknydefmkllgissdviekarnfkivtevqqdgqdftwsqhysgghtmt
nkftvgkesniqtmggktfkatvqmeggklvvnfpnyhqtseivgdklvevstiggvtye
rvskrl

SCOPe Domain Coordinates for d5l8nb_:

Click to download the PDB-style file with coordinates for d5l8nb_.
(The format of our PDB-style files is described here.)

Timeline for d5l8nb_: