Lineage for d5jtmd_ (5jtm D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943115Family d.33.1.0: automated matches [321736] (1 protein)
    not a true family
  6. 2943116Protein automated matches [321737] (2 species)
    not a true protein
  7. 2943117Species Escherichia coli [TaxId:585055] [321756] (1 PDB entry)
  8. 2943121Domain d5jtmd_: 5jtm D: [321757]
    automated match to d1fx3b_

Details for d5jtmd_

PDB Entry: 5jtm (more details)

PDB Description: the structure of chaperone secb in complex with unstructured phoa binding site a
PDB Compounds: (D:) protein-export protein secb

SCOPe Domain Sequences for d5jtmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtmd_ d.33.1.0 (D:) automated matches {Escherichia coli [TaxId: 585055]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda

SCOPe Domain Coordinates for d5jtmd_:

Click to download the PDB-style file with coordinates for d5jtmd_.
(The format of our PDB-style files is described here.)

Timeline for d5jtmd_: