![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
![]() | Superfamily d.33.1: SecB-like [54611] (3 families) ![]() |
![]() | Family d.33.1.0: automated matches [321736] (1 protein) not a true family |
![]() | Protein automated matches [321737] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:585055] [321756] (1 PDB entry) |
![]() | Domain d5jtmd_: 5jtm D: [321757] automated match to d1fx3b_ |
PDB Entry: 5jtm (more details)
SCOPe Domain Sequences for d5jtmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jtmd_ d.33.1.0 (D:) automated matches {Escherichia coli [TaxId: 585055]} mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr gtfpqlnlapvnfdalfmnylqqqagegteehqda
Timeline for d5jtmd_: