Lineage for d5db4b_ (5db4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860981Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2861015Domain d5db4b_: 5db4 B: [321755]
    automated match to d4ymib_
    complexed with atp, mg

Details for d5db4b_

PDB Entry: 5db4 (more details), 2.28 Å

PDB Description: mycobacterium abscessus nadd in complex with mg-atp, space group i41
PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5db4b_:

Sequence, based on SEQRES records: (download)

>d5db4b_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqpwqkqgrkvspaehrylmt
viatasnprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenwe
qlftlakfigvsrpgyelssdhiahaelppdglslvevpalaisstdcriragqarpiwy
lvpdgvvqyvakhrlysg

Sequence, based on observed residues (ATOM records): (download)

>d5db4b_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqrkvspaehrylmtviatas
nprftvsradidrggatytvdtltdlrtahpdadlyfitgadalaseqlftlakfigvsr
pgyelssdglslvevpalaisstdcriragqarpiwylvpdgvvqyvakhrlysg

SCOPe Domain Coordinates for d5db4b_:

Click to download the PDB-style file with coordinates for d5db4b_.
(The format of our PDB-style files is described here.)

Timeline for d5db4b_: