SCOPe 2.08: Domain d5db4b_: 5db4 B:

Lineage for d5db4b_ (5db4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)

8. Domain d5db4b_: 5db4 B: [321755]
   automated match to d4ymib_
   complexed with atp, mg

Details for d5db4b_

PDB Entry: 5db4, 2.28 Å

PDB Description: mycobacterium abscessus nadd in complex with mg-atp, space group i41

PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d5db4b_:

Sequence, based on SEQRES records:

>d5db4b_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqpwqkqgrkvspaehrylmt
viatasnprftvsradidrggatytvdtltdlrtahpdadlyfitgadalasilswenwe
qlftlakfigvsrpgyelssdhiahaelppdglslvevpalaisstdcriragqarpiwy
lvpdgvvqyvakhrlysg

Sequence, based on observed residues (ATOM records):

>d5db4b_ c.26.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
rrrlgvmggtfdpihnghlvaasevadrfaldevifvptgqrkvspaehrylmtviatas
nprftvsradidrggatytvdtltdlrtahpdadlyfitgadalaseqlftlakfigvsr
pgyelssdglslvevpalaisstdcriragqarpiwylvpdgvvqyvakhrlysg

Timeline for d5db4b_:

• d5db4b_ first appeared in SCOPe 2.06
  
• d5db4b_ appears in SCOPe 2.07