| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.129: MCP/YpsA-like [102404] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567 |
Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) ![]() |
| Family c.129.1.0: automated matches [233357] (1 protein) not a true family |
| Protein automated matches [233358] (8 species) not a true protein |
| Species Corynebacterium glutamicum [TaxId:196627] [321750] (2 PDB entries) |
| Domain d5itsa_: 5its A: [321751] Other proteins in same PDB: d5itsb2, d5itsd2 automated match to d1t35e_ complexed with gol, po4 |
PDB Entry: 5its (more details), 2.3 Å
SCOPe Domain Sequences for d5itsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5itsa_ c.129.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tlqrvtvftgsalgssslytqaaqtlaktavdrgidlvygggkvglmgivadaflesgge
afgviteslmkgelgheklteleivpdmhirkrrmaelgdgfiampggagtleelfevwt
wqqlgihqkpvalydvdgfwqpllemleqmtqrgfikrdffeclivesdphallkamqtw
tpp
Timeline for d5itsa_: