SCOPe 2.08: Domain d5abra_: 5abr A:

Lineage for d5abra_ (5abr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [321679] (1 PDB entry)

8. Domain d5abra_: 5abr A: [321747]
   automated match to d1m2ab_
   complexed with fes

Details for d5abra_

PDB Entry: 5abr, 2.11 Å

PDB Description: structure of fesi protein from azotobacter vinelandii

PDB Compounds: (A:) ferredoxin, 2fe-2s

SCOPe Domain Sequences for d5abra_:

Sequence; same for both SEQRES and ATOM records:

>d5abra_ c.47.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
pefhificaqnrpaghprgscgakgaegvynafaqvliqknltnrialtttgclgpcqag
anvliypgavmyswvepadaaiiveqhllggepyadkltpaeiw

Timeline for d5abra_:

• d5abra_ first appeared in SCOPe 2.06
  
• d5abra_ appears in SCOPe 2.07