Lineage for d5imya_ (5imy A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252153Fold f.9: Perfringolysin [56977] (1 superfamily)
    2 domains: (1) alpha+beta; (2) all-beta, similar to the CalB domain fold but the two last strands are transposed
  4. 2252154Superfamily f.9.1: Perfringolysin [56978] (2 families) (S)
    automatically mapped to Pfam PF01289
  5. 2252174Family f.9.1.0: automated matches [254195] (1 protein)
    not a true family
  6. 2252175Protein automated matches [254427] (4 species)
    not a true protein
  7. 2252176Species Gardnerella vaginalis [TaxId:2702] [321723] (1 PDB entry)
  8. 2252177Domain d5imya_: 5imy A: [321745]
    Other proteins in same PDB: d5imyc_, d5imyd_
    automated match to d1s3ra_

Details for d5imya_

PDB Entry: 5imy (more details), 2.4 Å

PDB Description: trapped toxin
PDB Compounds: (A:) Vaginolysin

SCOPe Domain Sequences for d5imya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5imya_ f.9.1.0 (A:) automated matches {Gardnerella vaginalis [TaxId: 2702]}
tscaakkdslnnylwdlqydktnilarhgetienkfssdsfnkngefvvvehqkknitnt
tsnlsvtsanddrvypgalfradknlmdnmpslisanrapitlsvdlpgfhggesavtvq
rptkssvtsavnglvskwnaqygashhvaarmqydsasaqsmnqlkakfgadfakigvpl
kidfdavhkgekqtqivnfkqtyytvsvdapdspadffapcttpdslknrgvdnkrppvy
vsnvaygrsmyvkfdttskstdfqaaveaaikgveikpntefhrilqntsvcavilggsa
ngaakvctgnidtlkaliqeganlstsspavpiayttsfvkdnevatlqsnsdyietkvs
syrngyltldhrgayvaryyiywdeygteidgtpyvrsrawegngkyrtahfnttiqfkg
nvrnlriklvektglvwepwrtvydrsdlplvrqrtisnwgttlwprvaetvkn

SCOPe Domain Coordinates for d5imya_:

Click to download the PDB-style file with coordinates for d5imya_.
(The format of our PDB-style files is described here.)

Timeline for d5imya_: