Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.9: Perfringolysin [56977] (1 superfamily) 2 domains: (1) alpha+beta; (2) all-beta, similar to the CalB domain fold but the two last strands are transposed |
Superfamily f.9.1: Perfringolysin [56978] (2 families) automatically mapped to Pfam PF01289 |
Family f.9.1.0: automated matches [254195] (1 protein) not a true family |
Protein automated matches [254427] (4 species) not a true protein |
Species Gardnerella vaginalis [TaxId:2702] [321723] (1 PDB entry) |
Domain d5imya_: 5imy A: [321745] Other proteins in same PDB: d5imyc_, d5imyd_ automated match to d1s3ra_ |
PDB Entry: 5imy (more details), 2.4 Å
SCOPe Domain Sequences for d5imya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5imya_ f.9.1.0 (A:) automated matches {Gardnerella vaginalis [TaxId: 2702]} tscaakkdslnnylwdlqydktnilarhgetienkfssdsfnkngefvvvehqkknitnt tsnlsvtsanddrvypgalfradknlmdnmpslisanrapitlsvdlpgfhggesavtvq rptkssvtsavnglvskwnaqygashhvaarmqydsasaqsmnqlkakfgadfakigvpl kidfdavhkgekqtqivnfkqtyytvsvdapdspadffapcttpdslknrgvdnkrppvy vsnvaygrsmyvkfdttskstdfqaaveaaikgveikpntefhrilqntsvcavilggsa ngaakvctgnidtlkaliqeganlstsspavpiayttsfvkdnevatlqsnsdyietkvs syrngyltldhrgayvaryyiywdeygteidgtpyvrsrawegngkyrtahfnttiqfkg nvrnlriklvektglvwepwrtvydrsdlplvrqrtisnwgttlwprvaetvkn
Timeline for d5imya_: