SCOPe 2.07: Domain d5dszb1: 5dsz B:2-206

Lineage for d5dszb1 (5dsz B:2-206)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries)

8. Domain d5dszb1: 5dsz B:2-206 [321740]
   Other proteins in same PDB: d5dsza2, d5dsza3, d5dszb2, d5dszb3
   automated match to d2qn6a3

Details for d5dszb1

PDB Entry: 5dsz, 2.5 Å

PDB Description: gamma-subunit of the translation initiation factor 2 from s. solfataricus

PDB Compounds: (B:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d5dszb1:

Sequence, based on SEQRES records:

>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records):

>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtkrgmtiklgyaetnigvcesckkpeay
vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq
trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk
inidsliegieeyiktpy

Timeline for d5dszb1:

• d5dszb1 first appeared in SCOPe 2.06
  
• d5dszb1 appears in the current release, SCOPe 2.08