Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries) |
Domain d5dszb1: 5dsz B:2-206 [321740] Other proteins in same PDB: d5dsza2, d5dsza3, d5dszb2, d5dszb3 automated match to d2qn6a3 |
PDB Entry: 5dsz (more details), 2.5 Å
SCOPe Domain Sequences for d5dszb1:
Sequence, based on SEQRES records: (download)
>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]} awpkvqpevnigvvghvdhgkttlvqaitgiwtkrgmtiklgyaetnigvcesckkpeay vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk inidsliegieeyiktpy
Timeline for d5dszb1: