Lineage for d5dszb1 (5dsz B:2-206)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (30 species)
    not a true protein
  7. 2449336Species Sulfolobus solfataricus [TaxId:2287] [255781] (6 PDB entries)
  8. 2449340Domain d5dszb1: 5dsz B:2-206 [321740]
    Other proteins in same PDB: d5dsza2, d5dsza3, d5dszb2, d5dszb3
    automated match to d2qn6a3

Details for d5dszb1

PDB Entry: 5dsz (more details), 2.5 Å

PDB Description: gamma-subunit of the translation initiation factor 2 from s. solfataricus
PDB Compounds: (B:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d5dszb1:

Sequence, based on SEQRES records: (download)

>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records): (download)

>d5dszb1 c.37.1.8 (B:2-206) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtkrgmtiklgyaetnigvcesckkpeay
vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq
trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk
inidsliegieeyiktpy

SCOPe Domain Coordinates for d5dszb1:

Click to download the PDB-style file with coordinates for d5dszb1.
(The format of our PDB-style files is described here.)

Timeline for d5dszb1: