Lineage for d1vom_2 (1vom 2-33,80-747)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69902Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 69930Protein Myosin S1, motor domain [52642] (3 species)
  7. 69952Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (16 PDB entries)
  8. 69954Domain d1vom_2: 1vom 2-33,80-747 [32174]
    Other proteins in same PDB: d1vom_1

Details for d1vom_2

PDB Entry: 1vom (more details), 1.9 Å

PDB Description: complex between dictyostelium myosin and mgadp and vanadate at 1.9a resolution

SCOP Domain Sequences for d1vom_2:

Sequence, based on SEQRES records: (download)

>d1vom_2 c.37.1.9 (2-33,80-747) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum)}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafg
nakttrnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqlla
gataeekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifk
iiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlva
qhlnvekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsf
eqlcinytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgil
alldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwle
knkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatle
ttnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryy
llapnvprdaedsqkatdavlkhlnidpeqyrfgitkiffr

Sequence, based on observed residues (ATOM records): (download)

>d1vom_2 c.37.1.9 (2-33,80-747) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum)}
npihdrtsdyhkylkvkqgdsdlfkltvsdkrXrnpikfdgvedmselsylnepavfhnl
rvrynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsm
lddrqnqsllitgesgagktentkkviqylasvagrnqgvleqqilqanpileafgnakt
trnnnssrfgkfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagata
eekkalhlagpesfnylnqsgcvdikgvsdedefkitrqamdivgfsqeeqmsifkiiag
ilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhln
vekssssrdalvkalygrlflwlvkkinnvlcseraayfigvldisgfeifkvnsfeqlc
inytneklqqffnhhmfkveqeeylkekinwtfidfgldsqatidlidgrqppgilalld
eqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkd
plqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnp
hfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllap
vprdqkatnidpeqyrfgitkiffr

SCOP Domain Coordinates for d1vom_2:

Click to download the PDB-style file with coordinates for d1vom_2.
(The format of our PDB-style files is described here.)

Timeline for d1vom_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vom_1