SCOPe 2.08: Domain d5imyc1: 5imy C:1-77

Lineage for d5imyc1 (5imy C:1-77)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein CD59 [57355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries)

8. Domain d5imyc1: 5imy C:1-77 [321733]
   Other proteins in same PDB: d5imya1, d5imya2, d5imyb1, d5imyb2, d5imyc2, d5imyd2
   automated match to d2j8ba_

Details for d5imyc1

PDB Entry: 5imy, 2.4 Å

PDB Description: trapped toxin

PDB Compounds: (C:) cd59 glycoprotein

SCOPe Domain Sequences for d5imyc1:

Sequence; same for both SEQRES and ATOM records:

>d5imyc1 g.7.1.3 (C:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen

Timeline for d5imyc1:

• d5imyc1 first appeared in SCOPe 2.06, called d5imyc_
  
• d5imyc1 was called d5imyc_ in SCOPe 2.07