SCOPe 2.07: Domain d5dbqa_: 5dbq A:

Lineage for d5dbqa_ (5dbq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Anticarsia gemmatalis [TaxId:129554] [321688] (1 PDB entry)

8. Domain d5dbqa_: 5dbq A: [321731]
   automated match to d2vm1c_

Details for d5dbqa_

PDB Entry: 5dbq, 1.95 Å

PDB Description: crystal structure of insect thioredoxin at 1.95 angstroms

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5dbqa_:

Sequence; same for both SEQRES and ATOM records:

>d5dbqa_ c.47.1.0 (A:) automated matches {Anticarsia gemmatalis [TaxId: 129554]}
msihikdsddlktrlaeagdklvvidfmatwcgpckmigpkldemagemqdsivvvkvdv
decediateyninsmptfvfvkngkkieefsganvdklrntilklk

Timeline for d5dbqa_:

• d5dbqa_ first appeared in SCOPe 2.06
  
• d5dbqa_ appears in the current release, SCOPe 2.08, called d5dbqa1