Lineage for d5dbng_ (5dbn G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922679Species Escherichia coli [TaxId:668369] [321686] (1 PDB entry)
  8. 2922683Domain d5dbng_: 5dbn G: [321728]
    automated match to d3cdkc_
    complexed with cl, gol, peg, po4

Details for d5dbng_

PDB Entry: 5dbn (more details), 2.55 Å

PDB Description: crystal structure of atoda complex
PDB Compounds: (G:) Acetate CoA-transferase subunit alpha

SCOPe Domain Sequences for d5dbng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dbng_ c.124.1.0 (G:) automated matches {Escherichia coli [TaxId: 668369]}
tklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgig
plivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltptg
vgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplialaa
ditlvepdelvetgelqpdhivtpgavidhiivsq

SCOPe Domain Coordinates for d5dbng_:

Click to download the PDB-style file with coordinates for d5dbng_.
(The format of our PDB-style files is described here.)

Timeline for d5dbng_: