![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Escherichia coli [TaxId:668369] [321686] (1 PDB entry) |
![]() | Domain d5dbng_: 5dbn G: [321728] automated match to d3cdkc_ complexed with cl, gol, peg, po4 |
PDB Entry: 5dbn (more details), 2.55 Å
SCOPe Domain Sequences for d5dbng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dbng_ c.124.1.0 (G:) automated matches {Escherichia coli [TaxId: 668369]} tklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtgig plivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltptg vgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplialaa ditlvepdelvetgelqpdhivtpgavidhiivsq
Timeline for d5dbng_: